| DOT Name |
NADH dehydrogenase 1 subunit C2, isoform 2 (NDUFC2-KCTD14)
|
| Synonyms |
NDUFC2-KCTD14 readthrough transcript protein |
| Gene Name |
NDUFC2-KCTD14
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG
|
| Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
|
| KEGG Pathway |
- Oxidative phosphorylation (hsa00190 )
- Metabolic pathways (hsa01100 )
- Thermogenesis (hsa04714 )
- Retrograde endocan.binoid sig.ling (hsa04723 )
- Non-alcoholic fatty liver disease (hsa04932 )
- Alzheimer disease (hsa05010 )
- Parkinson disease (hsa05012 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Huntington disease (hsa05016 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Chemical carcinogenesis - reactive oxygen species (hsa05208 )
- Diabetic cardiomyopathy (hsa05415 )
|
|
|
|
|
|
|