Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNITN8H)

• DOT Name: Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B)
• Gene Name: COQ10B
• Related Disease: Schizophrenia
• UniProt ID: CQ10B_HUMAN
• Pfam ID: PF03364
• Sequence:
  MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEIC
  ARTFFKITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGY
  CKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTL
  DFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRELMLHEVHHT
• Function: Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes.
• Reactome Pathway: Respiratory electron transport (R-HSA-611105)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[5]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[6]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[7]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[8]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (COQ10B).	[9]

References

• [1] Association of Schizophrenia Risk With Disordered Niacin Metabolism in an Indian Genome-wide Association Study.JAMA Psychiatry. 2019 Oct 1;76(10):1026-1034. doi: 10.1001/jamapsychiatry.2019.1335.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [7] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [8] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [9] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.