Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO2YA2O)

• DOT Name: Dehydrogenase/reductase SDR family member 7B (DHRS7B)
• Synonyms: EC 1.1.-.-; Short-chain dehydrogenase/reductase family 32C member 1; Protein SDR32C1
• Gene Name: DHRS7B
• UniProt ID: DRS7B_HUMAN
• EC Number: 1.1.-.-
• Pfam ID: PF00106
• Sequence:
  MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGA
  TSGLGKECAKVFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSG
  AIVAAAAEILQCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPS
  MIKRRQGHIVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYI
  HTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYL
  RTLAPGLFFSLMASRARKERKSKNS
• Function: Putative oxidoreductase.
• Reactome Pathway: Plasmalogen biosynthesis (R-HSA-75896)

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[5]
Selenium	DM25CGV	Approved	Selenium increases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[6]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Dehydrogenase/reductase SDR family member 7B (DHRS7B).	[8]

References

• [1] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.