General Information of Drug Off-Target (DOT) (ID: OTOALKQN)

DOT Name Odontogenesis associated phosphoprotein (ODAPH)
Gene Name ODAPH
Related Disease
Amelogenesis imperfecta ( )
Amelogenesis imperfecta hypomaturation type 2A4 ( )
Amelogenesis imperfecta type 2 ( )
UniProt ID
ODAPH_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15848
Sequence
MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTR
AQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRR
LQRGSSSEES
Function May promote nucleation of hydroxyapatite.
Tissue Specificity Highly expressed in placenta.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Amelogenesis imperfecta DISGYR9E Definitive Genetic Variation [1]
Amelogenesis imperfecta hypomaturation type 2A4 DISOZEXQ Definitive Autosomal recessive [2]
Amelogenesis imperfecta type 2 DISX8NN4 Supportive Autosomal recessive [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Odontogenesis associated phosphoprotein (ODAPH). [3]
Triclosan DMZUR4N Approved Triclosan increases the expression of Odontogenesis associated phosphoprotein (ODAPH). [4]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Odontogenesis associated phosphoprotein (ODAPH). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Odontogenesis associated phosphoprotein (ODAPH). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Odontogenesis associated phosphoprotein (ODAPH). [5]
------------------------------------------------------------------------------------

References

1 Amelogenesis Imperfecta: 1 Family, 2 Phenotypes, and 2 Mutated Genes.J Dent Res. 2016 Dec;95(13):1457-1463. doi: 10.1177/0022034516663200. Epub 2016 Aug 24.
2 Mutations in C4orf26, encoding a peptide with in vitro hydroxyapatite crystal nucleation and growth activity, cause amelogenesis imperfecta. Am J Hum Genet. 2012 Sep 7;91(3):565-71. doi: 10.1016/j.ajhg.2012.07.020. Epub 2012 Aug 16.
3 Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.