Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTODJZY9)

DOT Name	DnaJ homolog subfamily B member 3 (DNAJB3)
Gene Name	DNAJB3
Related Disease	Non-insulin dependent diabetes ( ) Obesity ( )
UniProt ID	DNJB3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2EJ7
Pfam ID	PF00226
Sequence	MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAK KRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLE NILGGSEELLGKQKQSVCTPFLCLQ
Function	May operate as a co-chaperone of the male germ cell- and haploid stage-specific Hsp70 proteins.
Tissue Specificity	Expressed in sperm (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[1]
Obesity	DIS47Y1K	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of DnaJ homolog subfamily B member 3 (DNAJB3).	[3]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of DnaJ homolog subfamily B member 3 (DNAJB3).	[4]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of DnaJ homolog subfamily B member 3 (DNAJB3).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of DnaJ homolog subfamily B member 3 (DNAJB3).	[5]
------------------------------------------------------------------------------------

References

1	DNAJB3 attenuates metabolic stress and promotes glucose uptake by eliciting Glut4 translocation.Sci Rep. 2019 Mar 18;9(1):4772. doi: 10.1038/s41598-019-41244-8.
2	DNAJB3/HSP-40 cochaperone is downregulated in obese humans and is restored by physical exercise.PLoS One. 2013 Jul 24;8(7):e69217. doi: 10.1371/journal.pone.0069217. Print 2013.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
5	Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.