Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOFJLFA)

DOT Name	Calmodulin-like protein 5 (CALML5)
Synonyms	Calmodulin-like skin protein
Gene Name	CALML5
Related Disease	Alzheimer disease ( ) Psoriasis ( ) Skin disease ( )
UniProt ID	CALL5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2B1U
Pfam ID	PF13499
Sequence	MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD AMIREADVDQDGRVNYEEFARMLAQE
Function	Binds calcium. May be involved in terminal differentiation of keratinocytes.
Tissue Specificity	Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.
KEGG Pathway	Ras sig.ling pathway (hsa04014 ) Rap1 sig.ling pathway (hsa04015 ) Calcium sig.ling pathway (hsa04020 ) cGMP-PKG sig.ling pathway (hsa04022 ) cAMP sig.ling pathway (hsa04024 ) Phosphatidylinositol sig.ling system (hsa04070 ) Oocyte meiosis (hsa04114 ) Cellular senescence (hsa04218 ) Adrenergic sig.ling in cardiomyocytes (hsa04261 ) Vascular smooth muscle contraction (hsa04270 ) Apelin sig.ling pathway (hsa04371 ) C-type lectin receptor sig.ling pathway (hsa04625 ) Circadian entrainment (hsa04713 ) Long-term potentiation (hsa04720 ) Neurotrophin sig.ling pathway (hsa04722 ) Dopaminergic sy.pse (hsa04728 ) Olfactory transduction (hsa04740 ) Phototransduction (hsa04744 ) Inflammatory mediator regulation of TRP channels (hsa04750 ) Insulin sig.ling pathway (hsa04910 ) GnRH sig.ling pathway (hsa04912 ) Estrogen sig.ling pathway (hsa04915 ) Melanogenesis (hsa04916 ) Oxytocin sig.ling pathway (hsa04921 ) Glucagon sig.ling pathway (hsa04922 ) Renin secretion (hsa04924 ) Aldosterone synthesis and secretion (hsa04925 ) Salivary secretion (hsa04970 ) Gastric acid secretion (hsa04971 ) Alzheimer disease (hsa05010 ) Parkinson disease (hsa05012 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Amphetamine addiction (hsa05031 ) Alcoholism (hsa05034 ) Pertussis (hsa05133 ) Tuberculosis (hsa05152 ) Human cytomegalovirus infection (hsa05163 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Human immunodeficiency virus 1 infection (hsa05170 ) Pathways in cancer (hsa05200 ) Glioma (hsa05214 ) Lipid and atherosclerosis (hsa05417 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Psoriasis	DIS59VMN	Strong	Biomarker	[2]
Skin disease	DISDW8R6	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Calmodulin-like protein 5 (CALML5).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Calmodulin-like protein 5 (CALML5).	[6]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Calmodulin-like protein 5 (CALML5).	[4]
Acocantherin	DM7JT24	Approved	Acocantherin affects the expression of Calmodulin-like protein 5 (CALML5).	[5]
------------------------------------------------------------------------------------

References

1	Calmodulin-like skin protein suppresses the increase in senescence-associated -galactosidase induced by hydrogen peroxide or ultraviolet irradiation in keratinocytes.Cell Biol Int. 2019 Jul;43(7):835-843. doi: 10.1002/cbin.11159. Epub 2019 May 18.
2	Influence of calcium on the proteolytic degradation of the calmodulin-like skin protein (calmodulin-like protein 5) in psoriatic epidermis.Exp Dermatol. 2006 Jun;15(6):469-77. doi: 10.1111/j.1600-0625.2006.00433.x.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
5	Proteomics analysis of the proliferative effect of low-dose ouabain on human endothelial cells. Biol Pharm Bull. 2007 Feb;30(2):247-53. doi: 10.1248/bpb.30.247.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.