| DOT Name |
Calmodulin-like protein 5 (CALML5)
|
| Synonyms |
Calmodulin-like skin protein |
| Gene Name |
CALML5
|
| Related Disease |
- Alzheimer disease ( )
- Psoriasis ( )
- Skin disease ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| Pfam ID |
|
| Sequence |
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD AMIREADVDQDGRVNYEEFARMLAQE
|
| Function |
Binds calcium. May be involved in terminal differentiation of keratinocytes. |
| Tissue Specificity |
Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung. |
| KEGG Pathway |
- Ras sig.ling pathway (hsa04014 )
- Rap1 sig.ling pathway (hsa04015 )
- Calcium sig.ling pathway (hsa04020 )
- cGMP-PKG sig.ling pathway (hsa04022 )
- cAMP sig.ling pathway (hsa04024 )
- Phosphatidylinositol sig.ling system (hsa04070 )
- Oocyte meiosis (hsa04114 )
- Cellular senescence (hsa04218 )
- Adrenergic sig.ling in cardiomyocytes (hsa04261 )
- Vascular smooth muscle contraction (hsa04270 )
- Apelin sig.ling pathway (hsa04371 )
- C-type lectin receptor sig.ling pathway (hsa04625 )
- Circadian entrainment (hsa04713 )
- Long-term potentiation (hsa04720 )
- Neurotrophin sig.ling pathway (hsa04722 )
- Dopaminergic sy.pse (hsa04728 )
- Olfactory transduction (hsa04740 )
- Phototransduction (hsa04744 )
- Inflammatory mediator regulation of TRP channels (hsa04750 )
- Insulin sig.ling pathway (hsa04910 )
- GnRH sig.ling pathway (hsa04912 )
- Estrogen sig.ling pathway (hsa04915 )
- Melanogenesis (hsa04916 )
- Oxytocin sig.ling pathway (hsa04921 )
- Glucagon sig.ling pathway (hsa04922 )
- Renin secretion (hsa04924 )
- Aldosterone synthesis and secretion (hsa04925 )
- Salivary secretion (hsa04970 )
- Gastric acid secretion (hsa04971 )
- Alzheimer disease (hsa05010 )
- Parkinson disease (hsa05012 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Amphetamine addiction (hsa05031 )
- Alcoholism (hsa05034 )
- Pertussis (hsa05133 )
- Tuberculosis (hsa05152 )
- Human cytomegalovirus infection (hsa05163 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- Pathways in cancer (hsa05200 )
- Glioma (hsa05214 )
- Lipid and atherosclerosis (hsa05417 )
- Fluid shear stress and atherosclerosis (hsa05418 )
|
| Reactome Pathway |
- Neutrophil degranulation (R-HSA-6798695 )
|
|
|
|
|
|
|