Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOK78E0)

• DOT Name: Quinone oxidoreductase-like protein 1 (CRYZL1)
• Synonyms: EC 1.-.-.-; Protein 4P11; Quinone oxidoreductase homolog 1; QOH-1; Zeta-crystallin homolog
• Gene Name: CRYZL1
• UniProt ID: QORL1_HUMAN
• PDB ID: 7ND2; 8A3O
• EC Number: 1.-.-.-
• Sequence:
  MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLF
  PVGREIAGIVLDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWT
  EAAGSIRDGVRAYTALHYLSHLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLE
  DKQCLERFRPPIARVIDVSNGKVHVAESCLEETGGLGVDIVLDAGVRLYSKDDEPAVKLQ
  LLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGATLAFLNDEVWNLSNVQQGKY
  LCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[6]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[7]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Quinone oxidoreductase-like protein 1 (CRYZL1).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [8] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.