Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTOQJBRZ)
| DOT Name | Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3) | ||||
|---|---|---|---|---|---|
| Synonyms | Rhodanese domain-containing protein 3 | ||||
| Gene Name | TSTD3 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQK
IPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS |
||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
5 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
References
