Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTP9WC4R)
| DOT Name | Purkinje cell protein 4-like protein 1 (PCP4L1) | ||||
|---|---|---|---|---|---|
| Synonyms | PCP4-like protein 1 | ||||
| Gene Name | PCP4L1 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQ
KRKKDPSS |
||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||||||
|
4 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||
References
