Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPBXY2P)

DOT Name tRNA 2'-phosphotransferase 1 (TRPT1)
Synonyms EC 2.7.1.160
Gene Name TRPT1
UniProt ID
TRPT1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7YW3
EC Number
2.7.1.160
Pfam ID
PF01885
Sequence
MNFSGGGRQEAAGSRGRRAPRPREQDRDVQLSKALSYALRHGALKLGLPMGADGFVPLGT
LLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLET
PQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFID
GPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSS
PKHSSRERRRIQQ
Function Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.
Tissue Specificity Widely expressed. Weakly or not expressed in lung, spleen, small intestine and peripheral blood leukocytes.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of tRNA 2'-phosphotransferase 1 (TRPT1). [1]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of tRNA 2'-phosphotransferase 1 (TRPT1). [6]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of tRNA 2'-phosphotransferase 1 (TRPT1). [2]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of tRNA 2'-phosphotransferase 1 (TRPT1). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of tRNA 2'-phosphotransferase 1 (TRPT1). [4]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of tRNA 2'-phosphotransferase 1 (TRPT1). [5]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
3 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.