Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPH2XLW)

DOT Name Ropporin-1B (ROPN1B)
Synonyms Rhophilin-associated protein 1B
Gene Name ROPN1B
Related Disease
Melanoma ( )
UniProt ID
ROP1B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVA
LCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHV
SRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Function Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY moderate Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Ropporin-1B (ROPN1B). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Ropporin-1B (ROPN1B). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Ropporin-1B (ROPN1B). [4]
------------------------------------------------------------------------------------

References

1 Diagnostic SOX10 gene signatures in salivary adenoid cystic and breast basal-like carcinomas.Br J Cancer. 2013 Jul 23;109(2):444-51. doi: 10.1038/bjc.2013.326. Epub 2013 Jun 25.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.