Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPMYIGD)

• DOT Name: Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D)
• Synonyms: Four scavenger receptor cysteine-rich domains-containing protein; S4D-SRCRB
• Gene Name: SSC4D
• UniProt ID: SRB4D_HUMAN
• Pfam ID: PF00530
• Sequence:
  MHKEAEMLIGPQLDEKRWGWRLGDGSAAPPFLPQALSFLLLLPLASALQPTPLPFQELRL
  VGGPSRCRGRLEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPI
  LLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRKMLTSRAPPTTL
  PNGKSEGSVRLVGGANLCQGRVEILHSGLWGTVCDDDWGLPDAAVVCRQLGCGAAMAATT
  NAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGALCAGLGPPTLTALP
  SSATREDWAWQTDPSATGVGPQPSRETALLTTAAWAAGKKSGRLRLVGGPGPCRGRVEVL
  HAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARL
  SDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAH
  RCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNV
  KCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[8]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[9]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[2]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[6]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[10]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Scavenger receptor cysteine-rich domain-containing group B protein (SSC4D).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.