Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPPN39P)

DOT Name NADH-cytochrome b5 reductase-like (CYB5RL)
Synonyms EC 1.6.2.2
Gene Name CYB5RL
UniProt ID
NB5R5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
1.6.2.2
Pfam ID
PF00970 ; PF00175 ; PF09791
Sequence
MMAEREEDDDTEEAWMQLRPTEPLPSQCCGSGCSPCVFDLYHRDLARWEAAQASKDRSLL
RGPESQSCPSKLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD
DLEIQRAYTPISPANAEGYFEVLIKCYQMGLMSRYVESWRVGDTAFWRGPFGDFFYKPNQ
YGELLLLAAGTGLAPMVPILQSITDNENDETFVTLVGCFKTFESIYLKTFLQEQARFWNV
RTFFVLSQESSSEQLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIAR
CLLCAGLTEDSYFLF
Function NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Reactome Pathway
Erythrocytes take up carbon dioxide and release oxygen (R-HSA-1237044 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [1]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [3]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [4]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [5]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of NADH-cytochrome b5 reductase-like (CYB5RL). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
5 Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
6 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
7 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
8 Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.