| DOT Name |
DNA-directed RNA polymerase III subunit RPC3 (POLR3C)
|
| Synonyms |
RNA polymerase III subunit C3; DNA-directed RNA polymerase III subunit C; RNA polymerase III 62 kDa subunit; RPC62 |
| Gene Name |
POLR3C
|
| Related Disease |
- Gout ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
2XUB ; 2XV4 ; 5AFQ ; 7A6H ; 7AE1 ; 7AE3 ; 7AEA ; 7AST ; 7D58 ; 7D59 ; 7DN3 ; 7DU2 ; 7FJI ; 7FJJ ; 8ITY ; 8IUE ; 8IUH
|
| Pfam ID |
PF08221
; PF05645
; PF20912
|
| Sequence |
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ
|
| Function |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. Part of POLR3C/RPC3-POLR3F/RPC6-POLR3G/RPC7 heterotrimer, coordinates the dynamics of Pol III stalk and clamp modules during the transition from apo to elongation state. Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as a nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway. Preferentially binds single-stranded DNA (ssDNA) in a sequence-independent manner.
|
| KEGG Pathway |
- R. polymerase (hsa03020 )
- Cytosolic D.-sensing pathway (hsa04623 )
|
| Reactome Pathway |
- RNA Polymerase III Chain Elongation (R-HSA-73780 )
- RNA Polymerase III Transcription Termination (R-HSA-73980 )
- RNA Polymerase III Abortive And Retractive Initiation (R-HSA-749476 )
- RNA Polymerase III Transcription Initiation From Type 1 Promoter (R-HSA-76061 )
- RNA Polymerase III Transcription Initiation From Type 2 Promoter (R-HSA-76066 )
- RNA Polymerase III Transcription Initiation From Type 3 Promoter (R-HSA-76071 )
- Cytosolic sensors of pathogen-associated DNA (R-HSA-1834949 )
|
|
|
|
|
|
|