Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQEGHAB)

DOT Name Kita-kyushu lung cancer antigen 1 (CT83)
Synonyms KK-LC-1; Cancer/testis antigen 83
Gene Name CT83
Related Disease
Adenocarcinoma ( )
Testicular cancer ( )
Carcinoma ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Immunodeficiency ( )
Irritable bowel syndrome ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Stomach cancer ( )
Triple negative breast cancer ( )
Advanced cancer ( )
Squamous cell carcinoma ( )
Breast cancer ( )
Breast carcinoma ( )
UniProt ID
KKLC1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15204
Sequence
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVY
DLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Tissue Specificity Specifically expressed in testis. Expressed by cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenocarcinoma DIS3IHTY Definitive Altered Expression [1]
Testicular cancer DIS6HNYO Definitive Genetic Variation [1]
Carcinoma DISH9F1N Strong Altered Expression [2]
Gastric cancer DISXGOUK Strong Biomarker [3]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [4]
Immunodeficiency DIS093I0 Strong Biomarker [3]
Irritable bowel syndrome DIS27206 Strong Genetic Variation [5]
Lung cancer DISCM4YA Strong Altered Expression [3]
Lung carcinoma DISTR26C Strong Altered Expression [3]
Neoplasm DISZKGEW Strong Biomarker [3]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [2]
Stomach cancer DISKIJSX Strong Biomarker [3]
Triple negative breast cancer DISAMG6N Strong Altered Expression [6]
Advanced cancer DISAT1Z9 moderate Biomarker [4]
Squamous cell carcinoma DISQVIFL moderate Altered Expression [7]
Breast cancer DIS7DPX1 Limited Altered Expression [8]
Breast carcinoma DIS2UE88 Limited Altered Expression [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Permethrin DMZ0Q1G Approved Permethrin increases the expression of Kita-kyushu lung cancer antigen 1 (CT83). [9]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Kita-kyushu lung cancer antigen 1 (CT83). [10]
------------------------------------------------------------------------------------

References

1 Cancer/testis antigen expression as a predictor for epidermal growth factor receptor mutation and prognosis in lung adenocarcinoma.Eur J Cardiothorac Surg. 2013 Apr;43(4):759-64. doi: 10.1093/ejcts/ezs426. Epub 2012 Jul 22.
2 Frequent High Expression of Kita-Kyushu Lung Cancer Antigen-1 (KK-LC-1) in Gastric Cancer.Anticancer Res. 2015 Jun;35(6):3575-9.
3 Cancer targeting by TCR gene-engineered T cells directed against Kita-Kyushu Lung Cancer Antigen-1.J Immunother Cancer. 2019 Aug 28;7(1):229. doi: 10.1186/s40425-019-0678-x.
4 Hypomethylation-mediated activation of cancer/testis antigen KK-LC-1 facilitates hepatocellular carcinoma progression through activating the Notch1/Hes1 signalling.Cell Prolif. 2019 May;52(3):e12581. doi: 10.1111/cpr.12581. Epub 2019 Mar 20.
5 Lactase persistence/non-persistence genetic variants in irritable bowel syndrome in an endemic area for lactose malabsorption.J Gastroenterol Hepatol. 2012 Dec;27(12):1825-30. doi: 10.1111/j.1440-1746.2012.07259.x.
6 CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer.Oncotarget. 2015 Sep 22;6(28):25356-67. doi: 10.18632/oncotarget.4516.
7 Clinical significance of cancer/testis antigens expression in patients with non-small cell lung cancer.Lung Cancer. 2010 Apr;68(1):105-10. doi: 10.1016/j.lungcan.2009.05.010. Epub 2009 Jul 9.
8 Detection of KK-LC-1 Protein, a Cancer/Testis Antigen, in Patients with Breast Cancer.Anticancer Res. 2018 Oct;38(10):5923-5928. doi: 10.21873/anticanres.12937.
9 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.