Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQH3VSR)

• DOT Name: Cold shock domain-containing protein C2 (CSDC2)
• Synonyms: RNA-binding protein PIPPin
• Gene Name: CSDC2
• Related Disease:
  Pick disease
  Progressive supranuclear palsy
• UniProt ID: CSDC2_HUMAN
• Pfam ID: PF00313
• Sequence:
  MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSAT
  ARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPI
  PPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
• Function: RNA-binding factor which binds specifically to the very 3'-UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Pick disease	DISP6X50	Strong	Biomarker	[1]
Progressive supranuclear palsy	DISO5KRQ	Strong	Biomarker	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cold shock domain-containing protein C2 (CSDC2).	[2]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Cold shock domain-containing protein C2 (CSDC2).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cold shock domain-containing protein C2 (CSDC2).	[5]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Cold shock domain-containing protein C2 (CSDC2).	[7]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cold shock domain-containing protein C2 (CSDC2).	[4]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Cold shock domain-containing protein C2 (CSDC2).	[6]

References

• [1] Prognostic importance of apathy in syndromes associated with frontotemporal lobar degeneration.Neurology. 2019 Apr 2;92(14):e1547-e1557. doi: 10.1212/WNL.0000000000007249. Epub 2019 Mar 6.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [7] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.