Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQMMNNT)

DOT Name	Epididymal secretory glutathione peroxidase (GPX5)
Synonyms	EC 1.11.1.9; Epididymis-specific glutathione peroxidase-like protein; EGLP; Glutathione peroxidase 5; GPx-5; GSHPx-5
Gene Name	GPX5
Related Disease	Hyperglycemia ( )
UniProt ID	GPX5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2I3Y
EC Number	1.11.1.9
Pfam ID	PF00255
Sequence	MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK YVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIR WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
Function	Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Tissue Specificity	Epididymis.
KEGG Pathway	Glutathione metabolism (hsa00480 ) Metabolic pathways (hsa01100 ) Thyroid hormone synthesis (hsa04918 ) Amyotrophic lateral sclerosis (hsa05014 ) Huntington disease (hsa05016 ) Pathways of neurodegeneration - multiple diseases (hsa05022 )
Reactome Pathway	Detoxification of Reactive Oxygen Species (R-HSA-3299685 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Hyperglycemia	DIS0BZB5	Disputed	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Epididymal secretory glutathione peroxidase (GPX5).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Epididymal secretory glutathione peroxidase (GPX5).	[4]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Epididymal secretory glutathione peroxidase (GPX5).	[3]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Epididymal secretory glutathione peroxidase (GPX5).	[3]
THIOCTIC ACID	DMNFCXW	Investigative	THIOCTIC ACID increases the expression of Epididymal secretory glutathione peroxidase (GPX5).	[5]
------------------------------------------------------------------------------------

References

1	Pharmacological Effects of EGLP-1, a Novel Analog of Glucagon-Like Peptide-1, on Carbohydrate and Lipid Metabolism.Cell Physiol Biochem. 2018;48(3):1112-1122. doi: 10.1159/000491978. Epub 2018 Jul 24.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Quercetin reduces oxidative damage induced by paraquat via modulating expression of antioxidant genes in A549 cells. J Appl Toxicol. 2013 Dec;33(12):1460-7. doi: 10.1002/jat.2812. Epub 2012 Sep 20.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5	Cytoprotective effect of alpha-lipoic acid on paraquat-exposed human bronchial epithelial cells via activation of nuclear factor erythroid related factor-2 pathway. Biol Pharm Bull. 2013;36(5):802-11.