Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR0278F)

DOT Name DnaJ homolog subfamily C member 28 (DNAJC28)
Gene Name DNAJC28
UniProt ID
DJC28_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF09350 ; PF00226
Sequence
MNTMYVMMAQILRSHLIKATVIPNRVKMLPYFGIIRNRMMSTHKSKKKIREYYRLLNVEE
GCSADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNASQSKGEEE
EDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFP
DSVIVKNIRQSKQQKITQAIERLVEDLIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMT
HNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGNPMTPTEKKQWNHVCEQF
QENIRKLNKRINDFNLIVPILTRQKVHFDAQKEIVRAQKIYETLIKTKEVTDRNPNNLDQ
GEGEKTPEIKKGFLNWMNLWKFIKIRSF
Function May have a role in protein folding or as a chaperone.
Tissue Specificity Expressed in the fetal and adult brain, testis, uterus, spleen and liver.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of DnaJ homolog subfamily C member 28 (DNAJC28). [1]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of DnaJ homolog subfamily C member 28 (DNAJC28). [2]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of DnaJ homolog subfamily C member 28 (DNAJC28). [3]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of DnaJ homolog subfamily C member 28 (DNAJC28). [4]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of DnaJ homolog subfamily C member 28 (DNAJC28). [5]
------------------------------------------------------------------------------------

References

1 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
2 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
3 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
4 BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
5 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.