Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR1M2QR)

• DOT Name: Armadillo repeat-containing protein 7 (ARMC7)
• Gene Name: ARMC7
• UniProt ID: ARMC7_HUMAN
• PDB ID: 7DVQ
• Pfam ID: PF00514
• Sequence:
  MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLD
  LFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAIT
  TLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQ
  AHSALGIPLPRSVAPRQR
• Function: As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[3]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[5]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[6]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Armadillo repeat-containing protein 7 (ARMC7).	[7]

References

• [1] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [4] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [5] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.