Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR5PNH0)

• DOT Name: Putative monooxygenase p33MONOX (KIAA1191)
• Synonyms: EC 1.-.-.-; Brain-derived rescue factor p60MONOX; Flavin monooxygenase motif-containing protein of 33 kDa
• Gene Name: KIAA1191
• UniProt ID: P33MX_HUMAN
• EC Number: 1.-.-.-
• Pfam ID: PF15302
• Sequence:
  MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIP
  ERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQH
  FERQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTP
  HSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFA
  TQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVL
  TPTGF
• Function: Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.
• Tissue Specificity: Down-regulated in the occipital lobe of an early stage Alzheimer disease patients.

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Putative monooxygenase p33MONOX (KIAA1191).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Putative monooxygenase p33MONOX (KIAA1191).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Putative monooxygenase p33MONOX (KIAA1191).	[3]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Putative monooxygenase p33MONOX (KIAA1191).	[5]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Putative monooxygenase p33MONOX (KIAA1191).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Putative monooxygenase p33MONOX (KIAA1191).	[4]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [6] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.