Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRAJJIE)

DOT Name	Dynein axonemal assembly factor 10 (DNAAF10)
Synonyms	WD repeat-containing protein 92; WD repeat-containing protein Monad
Gene Name	DNAAF10
UniProt ID	DAA10_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3I2N
Pfam ID	PF00400
Sequence	MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLR EIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGI GGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEE RVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFD MRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDS EGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKI
Function	Key assembly factor specifically required for the stability of axonemal dynein heavy chains in cytoplasm.
Tissue Specificity	Widely expressed with the highest expression in testis.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Dynein axonemal assembly factor 10 (DNAAF10).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Dynein axonemal assembly factor 10 (DNAAF10).	[2]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Dynein axonemal assembly factor 10 (DNAAF10).	[3]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Dynein axonemal assembly factor 10 (DNAAF10).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Dynein axonemal assembly factor 10 (DNAAF10).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Dynein axonemal assembly factor 10 (DNAAF10).	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
2	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
3	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
4	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
5	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
6	Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.