Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTRGL3O1)
| DOT Name | Small integral membrane protein 6 (SMIM6) | ||||
|---|---|---|---|---|---|
| Gene Name | SMIM6 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGE
EE |
||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
5 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
References
