Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRKV2N8)

DOT Name	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 (B3GNT4)
Synonyms	EC 2.4.1.149; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4; BGnT-4; Beta-1,3-Gn-T4; Beta-1,3-N-acetylglucosaminyltransferase 4; Beta3Gn-T4
Gene Name	B3GNT4
UniProt ID	B3GN4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	2.4.1.149
Pfam ID	PF01762
Sequence	MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLRKAAKPAGDPT AHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFL LLAIKSQPGHVERRAAIRSTWGRVGGWARGRQLKLVFLLGVAGSAPPAQLLAYESREFDD ILQWDFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLDGWDPAQD LLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAEL FPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMW ALVTDEGLKCAAGPIPQR
Function	Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Has activity for type 2 oligosaccharides.
Tissue Specificity	Mainly expressed in brain tissues such as whole brain, hippocampus, amygdala, cerebellum and caudate nucleus. Also expressed in colon, esophagus and kidney.
KEGG Pathway	Glycosphingolipid biosynthesis - lacto and neolacto series (hsa00601 ) Metabolic pathways (hsa01100 )
Reactome Pathway	O-linked glycosylation of mucins (R-HSA-913709 ) Keratan sulfate biosynthesis (R-HSA-2022854 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Uric acid	DMA1MKT	Investigative	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 (B3GNT4) affects the abundance of Uric acid.	[4]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 (B3GNT4).	[1]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 (B3GNT4).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 (B3GNT4).	[3]
------------------------------------------------------------------------------------

References

1	PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
2	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.