Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTROUM09)

• DOT Name: Ret finger protein-like 4A (RFPL4A)
• Synonyms: RING finger protein 210
• Gene Name: RFPL4A
• Related Disease:
  Advanced cancer
  Colorectal carcinoma
• UniProt ID: RFPLA_HUMAN
• PDB ID: 2FBE
• Pfam ID: PF13765 ; PF11002 ; PF00622 ; PF15227
• Sequence:
  MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDD
  IKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRS
  GDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVL
  SSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHIYT
  FIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASAPVSSEGK

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Ret finger protein-like 4A (RFPL4A).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Ret finger protein-like 4A (RFPL4A).	[3]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Ret finger protein-like 4A (RFPL4A).	[4]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Ret finger protein-like 4A (RFPL4A).	[5]

References

• [1] RFPL4A increases the G1 population and decreases sensitivity to chemotherapy in human colorectal cancer cells.J Biol Chem. 2015 Mar 6;290(10):6326-37. doi: 10.1074/jbc.M114.614859. Epub 2015 Jan 20.
• [2] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [3] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [4] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [5] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.