Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRSC1CD)

• DOT Name: Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1)
• Synonyms: IRAK1-binding protein 1
• Gene Name: IRAK1BP1
• Related Disease: Sjogren syndrome
• UniProt ID: IKBP1_HUMAN
• Pfam ID: PF04402
• Sequence:
  MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSE
  VSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVEN
  AYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVE
  NAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHA
  ASKVFITFEVKGKEKRKKHL
• Function: Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Sjogren syndrome	DISUBX7H	Strong	Biomarker	[1]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[4]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[9]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[4]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1BP1).	[5]

References

• [1] Variants at multiple loci implicated in both innate and adaptive immune responses are associated with Sjgren's syndrome.Nat Genet. 2013 Nov;45(11):1284-92. doi: 10.1038/ng.2792. Epub 2013 Oct 6.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.