Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRWUHTE)

• DOT Name: Keratin-associated protein 3-1 (KRTAP3-1)
• Synonyms: High sulfur keratin-associated protein 3.1; Keratin-associated protein 3.1
• Gene Name: KRTAP3-1
• UniProt ID: KRA31_HUMAN
• Pfam ID: PF04579
• Sequence:
  MYCCALRSCSVPTGPATTFCSFDKSCRCGVCLPSTCPHEISLLQPICCDTCPPPCCKPDT
  YVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC
• Function: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
• Reactome Pathway: Keratinization (R-HSA-6805567)

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Keratin-associated protein 3-1 (KRTAP3-1).	[1]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Keratin-associated protein 3-1 (KRTAP3-1).	[2]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Keratin-associated protein 3-1 (KRTAP3-1).	[3]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Keratin-associated protein 3-1 (KRTAP3-1).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Keratin-associated protein 3-1 (KRTAP3-1).	[2]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Keratin-associated protein 3-1 (KRTAP3-1).	[4]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Keratin-associated protein 3-1 (KRTAP3-1).	[4]

References

• [1] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [4] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.