Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS3HGC9)

• DOT Name: Solute carrier family 2, facilitated glucose transporter member 7 (SLC2A7)
• Synonyms: Glucose transporter type 7; GLUT-7; hGLUT7
• Gene Name: SLC2A7
• UniProt ID: GTR7_HUMAN
• Pfam ID: PF00083
• Sequence:
  MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
  FERHATFMDGKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAI
  LMGVSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGV
  FLAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQAL
  RRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLRWQLLSIIVLMAGQQLSGIN
  AINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGS
  ACLVLTVVLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMV
  DGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRI
  FAKRNRVKLPEEKEETIDAGPPTASPAKETSF
• Function: Probable sugar transporter. Even if its physiological substrate is subject to discussion, it is able to transport glucose and fructose. Does not transport galactose, 2-deoxy-d-glucose and xylose.
• Tissue Specificity: Expressed in small intestine and colon . Weakly expressed in testis and prostate .
• Reactome Pathway: Cellular hexose transport (R-HSA-189200)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fructose	DM43AN2	Approved	Solute carrier family 2, facilitated glucose transporter member 7 (SLC2A7) increases the transport of Fructose.	[3]
D-glucose	DMMG2TO	Investigative	Solute carrier family 2, facilitated glucose transporter member 7 (SLC2A7) increases the transport of D-glucose.	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Solute carrier family 2, facilitated glucose transporter member 7 (SLC2A7).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Solute carrier family 2, facilitated glucose transporter member 7 (SLC2A7).	[2]

References

• [1] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Cloning and functional characterization of the human GLUT7 isoform SLC2A7 from the small intestine. Am J Physiol Gastrointest Liver Physiol. 2004 Jul;287(1):G236-42. doi: 10.1152/ajpgi.00396.2003. Epub 2004 Mar 19.