Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS82NCA)

• DOT Name: GTP-binding protein 10 (GTPBP10)
• Synonyms: Protein obg homolog 2; ObgH2
• Gene Name: GTPBP10
• Related Disease:
  Prostate cancer
  Prostate carcinoma
• UniProt ID: GTPBA_HUMAN
• PDB ID: 7OI6
• Pfam ID: PF01018 ; PF01926
• Sequence:
  MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKD
  RYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQ
  GGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
  TTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQ
  LSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPK
  DFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLL
  NLWISDTMSSTEPPSKHAVTTSKMDII
• Function: May be involved in the ribosome maturation process. Complements an ObgE(CgtA) function in E.coli ribosome maturation. Plays a role of GTPase in vitro. When missing, disorganization of the nucleolar architecture is observed.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Disputed	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Disputed	Biomarker	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of GTP-binding protein 10 (GTPBP10).	[2]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of GTP-binding protein 10 (GTPBP10).	[3]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of GTP-binding protein 10 (GTPBP10).	[4]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of GTP-binding protein 10 (GTPBP10).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of GTP-binding protein 10 (GTPBP10).	[5]

References

• [1] Identification and validation of regulatory SNPs that modulate transcription factor chromatin binding and gene expression in prostate cancer.Oncotarget. 2016 Aug 23;7(34):54616-54626. doi: 10.18632/oncotarget.10520.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.