Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSK1E88)

• DOT Name: T-cell acute lymphocytic leukemia protein 2 (TAL2)
• Synonyms: TAL-2; Class A basic helix-loop-helix protein 19; bHLHa19
• Gene Name: TAL2
• Related Disease:
  Neoplasm
  Adult T-cell leukemia/lymphoma
  T-cell acute lymphoblastic leukaemia
• UniProt ID: TAL2_HUMAN
• Pfam ID: PF00010
• Sequence:
  MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE
  QSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[2]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Disputed	Biomarker	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of T-cell acute lymphocytic leukemia protein 2 (TAL2).	[4]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of T-cell acute lymphocytic leukemia protein 2 (TAL2).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of T-cell acute lymphocytic leukemia protein 2 (TAL2).	[5]

References

• [1] Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer.Oncol Rep. 2012 Jan;27(1):286-92. doi: 10.3892/or.2011.1483. Epub 2011 Oct 3.
• [2] The leukemic oncogene tal-2 is expressed in the developing mouse brain.Brain Res Mol Brain Res. 1999 Feb 5;64(2):199-210. doi: 10.1016/s0169-328x(98)00323-4.
• [3] V(D)J-mediated translocations in lymphoid neoplasms: a functional assessment of genomic instability by cryptic sites.J Exp Med. 2002 Jan 7;195(1):85-98. doi: 10.1084/jem.20011578.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.