Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTSOSZEE)
| DOT Name | Aquaporin-7 (AQP7) | ||||
|---|---|---|---|---|---|
| Synonyms | AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like | ||||
| Gene Name | AQP7 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence | 
                            MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVL NKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQF LGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTG MLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIA GWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITV LPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF | ||||
| Function | 
                        Forms a channel that mediates water and glycerol transport across cell membranes at neutral pH. The channel is also permeable to urea. Plays an important role in body energy homeostasis under conditions that promote lipid catabolism, giving rise to glycerol and free fatty acids. Mediates glycerol export from adipocytes. After release into the blood stream, glycerol is used for gluconeogenesis in the liver to maintain normal blood glucose levels and prevent fasting hypoglycemia. Required for normal glycerol reabsorption in the kidney.
                        
                     | ||||
| Tissue Specificity | Detected in the sperm head (at protein level) . Detected in white adipose tissue . | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
| BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 Drug(s) Affected the Post-Translational Modifications of This DOT 
 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| 9 Drug(s) Affected the Gene/Protein Processing of This DOT 
 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
