Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSZ86MP)

• DOT Name: Endogenous Bornavirus-like nucleoprotein 2 (EBLN2)
• Synonyms: Endogenous Borna-like N element-2; EBLN-2
• Gene Name: EBLN2
• UniProt ID: EBLN2_HUMAN
• Pfam ID: PF06407
• Sequence:
  MGYFLKLYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSP
  GDDAMDRSGLPDLQGRFELSGKNRQYPLDALEPQPSIGDIKDIKKAAKSMLDPAHKSHFH
  PVTPSLVFLCFIFDGLHQALLSVGVSKRSNTVVGNENEERGTPYASRFKDMPNFIALEKS
  SVLRHCCDLLIGIAAGSSDKICTSSLQVQRRFKAMMASIGRLSHGESADLLISCNAESAI
  GWISSRPWVGELMFTLLFGDFESPLHKLRKSS
• Function: May act as an RNA-binding protein. The C-terminal region is highly homologous to the bornavirus nucleocapsid N protein that binds viral RNA and oligomerizes. The viral protein also possesses a nuclear import and a nuclear export signal. These 2 signals seem absent in EBLN-2 supporting an unrelated function in Human.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[2]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[3]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[2]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[2]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Endogenous Bornavirus-like nucleoprotein 2 (EBLN2).	[6]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [3] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [4] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [5] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.