Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT07ZC7)

DOT Name	Protein LZIC (LZIC)
Synonyms	Leucine zipper and CTNNBIP1 domain-containing protein; Leucine zipper and ICAT homologous domain-containing protein
Gene Name	LZIC
Related Disease	Osteosarcoma ( ) Neuroblastoma ( )
UniProt ID	LZIC_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF06384
Sequence	MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSL KKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVG KLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILAL ASFEVEKTKK
Tissue Specificity	Ubiquitously expressed, with highest levels in kidney. Up-regulated in several cases of gastric cancers.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[1]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein LZIC (LZIC).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein LZIC (LZIC).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein LZIC (LZIC).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein LZIC (LZIC).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein LZIC (LZIC).	[7]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Protein LZIC (LZIC).	[8]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Protein LZIC (LZIC).	[9]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Gene expression profiling of alpha-radiation-induced rat osteosarcomas: identification of dysregulated genes involved in radiation-induced tumorigenesis of bone.Int J Cancer. 2009 Aug 1;125(3):612-20. doi: 10.1002/ijc.24392.
2	Identification of a minimal region of loss on the short arm of chromosome 1 in Wilms tumor.Genes Chromosomes Cancer. 2007 Apr;46(4):327-35. doi: 10.1002/gcc.20413.
3	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
8	Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
9	Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.