Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT0UXI3)

DOT Name	Sterol O-acyltransferase 2 (SOAT2)
Synonyms	EC 2.3.1.26; Acyl-coenzyme A:cholesterol acyltransferase 2; ACAT-2; Cholesterol acyltransferase 2
Gene Name	SOAT2
UniProt ID	SOAT2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	7N6Q; 7N6R
EC Number	2.3.1.26
Pfam ID	PF03062
Sequence	MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQL RELLDRAMREAIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHF RTIYHMFIAGLCVFIISTLAIDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLA PYQALRLWARGTWTQATGLGCALLAAHAVVLCALPVHVAVEHQLPPASRCVLVFEQVRFL MKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTLIYRETYPRTPYVRWNYVAKN FAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFMLLLIFFAFLH CWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTM LFLGQGIQVSLYCQEWYARRHCPLPQATFWGLVTPRSWSCHT
Function	Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. Utilizes oleoyl-CoA ((9Z)-octadecenoyl-CoA) and linolenoyl-CoA ((9Z,12Z,15Z)-octadecatrienoyl-CoA) as substrates. May provide cholesteryl esters for lipoprotein secretion from hepatocytes and intestinal mucosa ; [Isoform 2]: Has lower enzymatic activity compared to isoform 1; [Isoform 3]: Has lower enzymatic activity compared to isoform 1.
Tissue Specificity	Expression seems confined in hepatocytes and enterocytes.
KEGG Pathway	Steroid biosynthesis (hsa00100 ) Cholesterol metabolism (hsa04979 )
Reactome Pathway	LDL clearance (R-HSA-8964038 )
BioCyc Pathway	MetaCyc:HS09636-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Sterol O-acyltransferase 2 (SOAT2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sterol O-acyltransferase 2 (SOAT2).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Sterol O-acyltransferase 2 (SOAT2).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Sterol O-acyltransferase 2 (SOAT2).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Sterol O-acyltransferase 2 (SOAT2).	[5]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Sterol O-acyltransferase 2 (SOAT2).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Sterol O-acyltransferase 2 (SOAT2).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Sterol O-acyltransferase 2 (SOAT2).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Sterol O-acyltransferase 2 (SOAT2).	[8]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Sterol O-acyltransferase 2 (SOAT2).	[9]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of Sterol O-acyltransferase 2 (SOAT2).	[10]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 decreases the expression of Sterol O-acyltransferase 2 (SOAT2).	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Drug(s)

References

1	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
5	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
6	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
7	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
8	Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
9	Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
10	Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
11	Gene expression profiles in HPV-immortalized human cervical cells treated with the nicotine-derived carcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Chem Biol Interact. 2009 Feb 12;177(3):173-80. doi: 10.1016/j.cbi.2008.10.051. Epub 2008 Nov 6.