Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT2YVJ7)

DOT Name	Cx9C motif-containing protein 4 (CMC4)
Synonyms	Mature T-cell proliferation 1 neighbor protein; Mature T-cell proliferation-1 type A; MTCP-1 type A; Protein p8 MTCP-1; p8MTCP1
Gene Name	CMC4
Related Disease	Moyamoya disease ( ) T-cell leukaemia ( ) Neoplasm ( )
UniProt ID	CMC4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1EI0; 1HP8; 2HP8
Pfam ID	PF08991
Sequence	MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN LTRKSASK
Tissue Specificity	Expressed in many tissues with a relatively high level in skeletal muscle.
Reactome Pathway	Mitochondrial protein import (R-HSA-1268020 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Moyamoya disease	DISO62CA	Strong	Genetic Variation	[1]
T-cell leukaemia	DISJ6YIF	Strong	Altered Expression	[2]
Neoplasm	DISZKGEW	Limited	Altered Expression	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Cx9C motif-containing protein 4 (CMC4).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Cx9C motif-containing protein 4 (CMC4).	[7]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cx9C motif-containing protein 4 (CMC4).	[5]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Cx9C motif-containing protein 4 (CMC4).	[6]
------------------------------------------------------------------------------------

References

1	Loss of BRCC3 deubiquitinating enzyme leads to abnormal angiogenesis and is associated with syndromic moyamoya.Am J Hum Genet. 2011 Jun 10;88(6):718-728. doi: 10.1016/j.ajhg.2011.04.017. Epub 2011 May 19.
2	The MTCP-1/c6.1B gene encodes for a cytoplasmic 8 kD protein overexpressed in T cell leukemia bearing a t(X;14) translocation.Oncogene. 1994 Dec;9(12):3565-70.
3	Abnormalities of chromosomes 8, 11, 14, and X in T-prolymphocytic leukemia studied by fluorescence in situ hybridization.Cancer Genet Cytogenet. 1998 Jun;103(2):110-6. doi: 10.1016/s0165-4608(97)00410-x.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6	Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.