Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTT2YVJ7)
| DOT Name | Cx9C motif-containing protein 4 (CMC4) | ||||
|---|---|---|---|---|---|
| Synonyms | Mature T-cell proliferation 1 neighbor protein; Mature T-cell proliferation-1 type A; MTCP-1 type A; Protein p8 MTCP-1; p8MTCP1 | ||||
| Gene Name | CMC4 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence |
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN
LTRKSASK |
||||
| Tissue Specificity | Expressed in many tissues with a relatively high level in skeletal muscle. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
3 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||
|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||
References
