| DOT Name |
T-cell-specific surface glycoprotein CD28 (CD28)
|
| Synonyms |
TP44; CD antigen CD28 |
| Gene Name |
CD28
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
1YJD ; 3WA4 ; 5AUL ; 5GJH ; 5GJI ; 6O8D ; 7PPN ; 7VU5
|
| Pfam ID |
|
| Sequence |
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
|
| Function |
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells.
|
| Tissue Specificity |
Expressed in T-cells and plasma cells, but not in less mature B-cells. |
| KEGG Pathway |
- Cell adhesion molecules (hsa04514 )
- T cell receptor sig.ling pathway (hsa04660 )
- Intesti.l immune network for IgA production (hsa04672 )
- Type I diabetes mellitus (hsa04940 )
- Measles (hsa05162 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
- Autoimmune thyroid disease (hsa05320 )
- Systemic lupus erythematosus (hsa05322 )
- Rheumatoid arthritis (hsa05323 )
- Allograft rejection (hsa05330 )
- Graft-versus-host disease (hsa05332 )
- Viral myocarditis (hsa05416 )
|
| Reactome Pathway |
- Nef mediated downregulation of CD28 cell surface expression (R-HSA-164939 )
- Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
- CD28 co-stimulation (R-HSA-389356 )
- CD28 dependent PI3K/Akt signaling (R-HSA-389357 )
- CD28 dependent Vav1 pathway (R-HSA-389359 )
- PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
- PIP3 activates AKT signaling (R-HSA-1257604 )
|
|
|
|
|
|
|