Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTT8D6CH)
| DOT Name | Beta-defensin 121 (DEFB121) | ||||
|---|---|---|---|---|---|
| Synonyms | Beta-defensin 21; DEFB-21; Defensin, beta 121 | ||||
| Gene Name | DEFB121 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVK
PKLTDTNTSLESTSAV |
||||
| Function | Has antibacterial activity. | ||||
| Tissue Specificity | Abundant expression in the male reproductive tract only. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||
References
