Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTGTQIQ)

• DOT Name: Beta-crystallin B3 (CRYBB3)
• Synonyms: Beta-B3 crystallin
• Gene Name: CRYBB3
• Related Disease:
  Cataract 22 multiple types
  Cataract
  Early-onset anterior polar cataract
  Early-onset nuclear cataract
  Neurofibromatosis type 2
• UniProt ID: CRBB3_HUMAN
• PDB ID: 3QK3
• Pfam ID: PF00030
• Sequence:
  MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQ
  VESGPWLAFESRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFE
  NPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRH
  WNEWDASQPQLQSVRRIRDQKWHKRGRFPSS
• Function: Crystallins are the dominant structural components of the vertebrate eye lens.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cataract 22 multiple types	DISHAACF	Definitive	Autosomal recessive	[1]
Cataract	DISUD7SL	Strong	Genetic Variation	[2]
Early-onset anterior polar cataract	DISTOPIY	Supportive	Autosomal dominant	[3]
Early-onset nuclear cataract	DISGIHUY	Supportive	Autosomal dominant	[3]
Neurofibromatosis type 2	DISI8ECS	Limited	Biomarker	[4]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Beta-crystallin B3 (CRYBB3).	[5]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Beta-crystallin B3 (CRYBB3).	[6]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Beta-crystallin B3 (CRYBB3).	[7]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Beta-crystallin B3 (CRYBB3).	[8]

References

• [1] Mutations in betaB3-crystallin associated with autosomal recessive cataract in two Pakistani families. Invest Ophthalmol Vis Sci. 2005 Jun;46(6):2100-6. doi: 10.1167/iovs.04-1481.
• [2] Distribution of gene mutations in sporadic congenital cataract in a Han Chinese population.Mol Vis. 2016 Jun 8;22:589-98. eCollection 2016.
• [3] Whole exome sequencing in dominant cataract identifies a new causative factor, CRYBA2, and a variety of novel alleles in known genes. Hum Genet. 2013 Jul;132(7):761-70. doi: 10.1007/s00439-013-1289-0. Epub 2013 Mar 19.
• [4] Direct assignment of the human beta B2 and beta B3 crystallin genes to 22q11.2----q12: markers for neurofibromatosis 2.Cytogenet Cell Genet. 1991;56(3-4):171-5. doi: 10.1159/000133080.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] The use of genomics technology to investigate gene expression changes in cultured human liver cells. Toxicol In Vitro. 2001 Aug-Oct;15(4-5):399-405. doi: 10.1016/s0887-2333(01)00043-1.