General Information of Drug Off-Target (DOT) (ID: OTTHBSUS)

DOT Name Alpha-hemoglobin-stabilizing protein (AHSP)
Synonyms Erythroid differentiation-related factor; Erythroid-associated factor
Gene Name AHSP
Related Disease
Anemia ( )
Atrial fibrillation ( )
Congestive heart failure ( )
Creutzfeldt Jacob disease ( )
Hematologic disease ( )
Obstructive sleep apnea ( )
Alpha thalassemia ( )
Fetal growth restriction ( )
Hemoglobin H disease ( )
Metastatic sarcoma ( )
UniProt ID
AHSP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1W09; 1W0A; 1W0B; 1XZY; 1Y01; 1Z8U; 3IA3; 3OVU
Pfam ID
PF09236
Sequence
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEP
QERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Function
Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.
Tissue Specificity Expressed in blood and bone marrow.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Anemia DISTVL0C Strong Biomarker [1]
Atrial fibrillation DIS15W6U Strong Biomarker [2]
Congestive heart failure DIS32MEA Strong Biomarker [3]
Creutzfeldt Jacob disease DISCB6RX Strong Biomarker [4]
Hematologic disease DIS9XD9A Strong Altered Expression [4]
Obstructive sleep apnea DIS0SVD1 Strong Biomarker [2]
Alpha thalassemia DIS5XGK0 moderate Biomarker [5]
Fetal growth restriction DIS5WEJ5 moderate Altered Expression [6]
Hemoglobin H disease DISHFWO5 moderate Altered Expression [5]
Metastatic sarcoma DISKYC7V moderate Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Alpha-hemoglobin-stabilizing protein (AHSP). [8]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Alpha-hemoglobin-stabilizing protein (AHSP). [10]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Alpha-hemoglobin-stabilizing protein (AHSP). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Alpha-hemoglobin-stabilizing protein (AHSP). [11]
------------------------------------------------------------------------------------

References

1 Transgenic human alpha-hemoglobin stabilizing protein could partially relieve betaIVS-2-654-thalassemia syndrome in model mice.Hum Gene Ther. 2010 Feb;21(2):149-56. doi: 10.1089/hum.2009.132.
2 Patient characteristics as predictors of recurrence of atrial fibrillation following cryoballoon ablation.Pacing Clin Electrophysiol. 2019 Jun;42(6):694-704. doi: 10.1111/pace.13669. Epub 2019 Apr 9.
3 Endothelial dysfunction in the pulmonary vascular bed.Am J Med Sci. 2000 Oct;320(4):223-32. doi: 10.1097/00000441-200010000-00001.
4 alpha-Hemoglobin stabilizing protein is not a suitable marker for a screening test for variant Creutzfeldt-Jakob disease.Transfusion. 2008 Aug;48(8):1616-26. doi: 10.1111/j.1537-2995.2008.01759.x. Epub 2008 May 22.
5 A molecular study on the role of alpha-hemoglobin-stabilizing protein in hemoglobin H disease.Ann Hematol. 2017 Jun;96(6):1005-1014. doi: 10.1007/s00277-017-2978-x. Epub 2017 Mar 23.
6 Alpha-hemoglobin-stabilizing protein (AHSP) in hemolysis, elevated liver enzyme, and low platelet (HELLP) syndrome, intrauterine growth restriction (IUGR) and fetal death.Cell Stress Chaperones. 2008 Spring;13(1):67-71. doi: 10.1007/s12192-008-0009-5. Epub 2008 Feb 6.
7 -Hemoglobin-stabilizing Protein: An Effective Marker for Erythroid Precursors in Bone Marrow Biopsy Specimens.Appl Immunohistochem Mol Morphol. 2016 Jan;24(1):51-6. doi: 10.1097/PAI.0000000000000139.
8 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
9 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
10 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.