Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTXP61X)

• DOT Name: 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2)
• Synonyms: EC 1.14.11.-
• Gene Name: OGFOD2
• UniProt ID: OGFD2_HUMAN
• EC Number: 1.14.11.-
• Sequence:
  MATVGAPRHFCRCACFCTDNLYVARYGLHVRFRGEQQLRRDYGPILRSRGCVSAKDFQQL
  LAELEQEVERRQRLGQESAARKALIASSYHPARPEVYDSLQDAALAPEFLAVTEYSVSPD
  ADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYGVLL
  HELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCHYDNAE
  LTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGER
  WNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2).	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2).	[3]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2).	[6]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN increases the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [4] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [7] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.