Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUCF3GW)

• DOT Name: Membrane-spanning 4-domains subfamily A member 12 (MS4A12)
• Gene Name: MS4A12
• Related Disease:
  Colon cancer
  Colon carcinoma
  Inflammatory bowel disease
  Bloom syndrome
  Neoplasm
• UniProt ID: M4A12_HUMAN
• Pfam ID: PF04103
• Sequence:
  MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIF
  ASSQPGQGNIQMINPSVGTAVMNFKEEAKALGVIQIMVGLMHIGFGIVLCLISFSFREVL
  GFASTAVIGGYPFWGGLSFIISGSLSVSASKELSRCLVKGSLGMNIVSSILAFIGVILLL
  VDMCINGVAGQDYWAVLSGKGISATLMIFSLLEFFVACATAHFANQANTTTNMSVLVIPN
  MYESNPVTPASSSAPPRCNNYSANAPK
• Function: May be involved in signal transduction as a component of a multimeric receptor complex.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colon cancer	DISVC52G	Strong	Biomarker	[1]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[1]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[2]
Bloom syndrome	DISKXQ7J	moderate	Genetic Variation	[1]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Membrane-spanning 4-domains subfamily A member 12 (MS4A12).	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Membrane-spanning 4-domains subfamily A member 12 (MS4A12).	[5]

References

• [1] Decreased expression of MS4A12 inhibits differentiation and predicts early stage survival in colon cancer.Neoplasma. 2017;64(1):65-73. doi: 10.4149/neo_2017_108.
• [2] CAV3 mutation in a patient with transient hyperCKemia and myalgia.Neurol Neurochir Pol. 2016 Nov-Dec;50(6):468-473. doi: 10.1016/j.pjnns.2016.06.008. Epub 2016 Jul 9.
• [3] Selective activation of tumor growth-promoting Ca2+ channel MS4A12 in colon cancer by caudal type homeobox transcription factor CDX2.Mol Cancer. 2009 Sep 25;8:77. doi: 10.1186/1476-4598-8-77.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.