Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUHIICR)

DOT Name	Small acidic protein (C11ORF58)
Gene Name	C11ORF58
Related Disease	Burkitt lymphoma ( ) Advanced cancer ( ) Neoplasm ( )
UniProt ID	SMAP_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15477
Sequence	MSAARESHPHGVKRSASPDDDLGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGD HKSTSHFRTGEEDKKINEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDD DDDDDDSPDPESPDDSESDSESEKEESAEELQAAEHPDEVEDPKNKKDAKSNYKMMFVKS SGS

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Burkitt lymphoma	DIS9D5XU	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[2]
Neoplasm	DISZKGEW	Limited	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Small acidic protein (C11ORF58).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Small acidic protein (C11ORF58).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Small acidic protein (C11ORF58).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Small acidic protein (C11ORF58).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Small acidic protein (C11ORF58).	[7]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Small acidic protein (C11ORF58).	[6]
------------------------------------------------------------------------------------

References

1	Protein phosphatase 2A activation as a therapeutic strategy for managing MYC-driven cancers.J Biol Chem. 2020 Jan 17;295(3):757-770. doi: 10.1074/jbc.RA119.011443. Epub 2019 Dec 10.
2	A SMAP in the face for cancer.J Clin Invest. 2017 Jun 1;127(6):2048-2050. doi: 10.1172/JCI94763. Epub 2017 May 15.
3	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
4	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.