Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTURD1GV)

DOT Name Nucleolar GTP-binding protein 2 (GNL2)
Synonyms Autoantigen NGP-1
Gene Name GNL2
Related Disease
Breast neoplasm ( )
Cardiac failure ( )
Congestive heart failure ( )
UniProt ID
NOG2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6LSS; 6LU8; 8FKZ; 8FL0; 8FL2; 8FL3; 8FL4; 8FL6; 8FL7; 8FL9; 8IDT; 8IDY; 8IE3; 8INE; 8INF; 8INK; 8IPD; 8IPX; 8IPY; 8IR1; 8IR3
Pfam ID
PF01926 ; PF08153
Sequence
MVKPKYKGRSTINPSKASTNPDRVQGAGGQNMRDRATIRRLNMYRQKERRNSRGKIIKPL
QYQSTVASGTVARVEPNIKWFGNTRVIKQSSLQKFQEEMDTVMKDPYKVVMKQSKLPMSL
LHDRIRPHNLKVHILDTESFETTFGPKSQRKRPNLFASDMQSLIENAEMSTESYDQGKDR
DLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPHIETY
LKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHASLTNPFGKGAFIQLLRQ
FGKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLI
DCPGVVYPSEDSETDIVLKGVVQVEKIKSPEDHIGAVLERAKPEYISKTYKIDSWENAED
FLEKLAFRTGKLLKGGEPDLQTVGKMVLNDWQRGRIPFFVKPPNAEPLVAPQLLPSSSLE
VVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVP
QFSGDDLVPVEVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKAL
DEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRK
AQREEEQEHSNKAPRALTSKERRRAVRQQRPKKVGVRYYETHNVKNRNRNKKKTNDSEGQ
KHKRKKFRQKQ
Function
GTPase that associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation. May promote cell proliferation possibly by increasing p53/TP53 protein levels, and consequently those of its downstream product CDKN1A/p21, and decreasing RPL23A protein levels.
Tissue Specificity Widely expressed, with the highest expression level in testis.
KEGG Pathway
Ribosome biogenesis in eukaryotes (hsa03008 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast neoplasm DISNGJLM Strong Biomarker [1]
Cardiac failure DISDC067 Strong Genetic Variation [2]
Congestive heart failure DIS32MEA Strong Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Nucleolar GTP-binding protein 2 (GNL2). [3]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Nucleolar GTP-binding protein 2 (GNL2). [4]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Nucleolar GTP-binding protein 2 (GNL2). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Nucleolar GTP-binding protein 2 (GNL2). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Nucleolar GTP-binding protein 2 (GNL2). [7]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Nucleolar GTP-binding protein 2 (GNL2). [8]
Marinol DM70IK5 Approved Marinol decreases the expression of Nucleolar GTP-binding protein 2 (GNL2). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Nucleolar GTP-binding protein 2 (GNL2). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Nucleolar GTP-binding protein 2 (GNL2). [10]
------------------------------------------------------------------------------------

References

1 Cloning of a novel nucleolar guanosine 5'-triphosphate binding protein autoantigen from a breast tumor.Cell Growth Differ. 1996 Feb;7(2):271-80.
2 Sex- and age-dependent human transcriptome variability: implications for chronic heart failure.Proc Natl Acad Sci U S A. 2003 Mar 4;100(5):2754-9. doi: 10.1073/pnas.0436564100. Epub 2003 Feb 24.
3 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
8 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
9 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.