Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUT18HF)

• DOT Name: Uncharacterized protein C16orf86 (C16ORF86)
• Gene Name: C16ORF86
• UniProt ID: CP086_HUMAN
• Pfam ID: PF15762
• Sequence:
  MASAGAERRPGVQEATVVGQGQLTEEPGSAQTSECPVAGDQFLVPAHEARGTQSEDQRPA
  GAASESELQEEGPKLGEERPKPHAGALEERGPRPVVSIVRPRHGPKRKPVKSLSLPGLRA
  HLKAEAELPPKLPLQEEEPEDSQSEPSPSAKQHKKAKKRKSLGAPVLHAVASMVSAPLET
  LRLERKAQRLRPLYQYVNYCNPELNQAGKGDGEAEVEAEAELAPVPEEGGVEQLQALLPL
  AGELGPGLALPCPSPLVTPTHALAPLGEEAGEEPGGLPSLGVSDHKAEVDKSTQVDIDKM
  LSVCTAPLVPPLSPQYK

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Uncharacterized protein C16orf86 (C16ORF86).	[1]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Uncharacterized protein C16orf86 (C16ORF86).	[2]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Uncharacterized protein C16orf86 (C16ORF86).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Uncharacterized protein C16orf86 (C16ORF86).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Uncharacterized protein C16orf86 (C16ORF86).	[3]

References

• [1] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [2] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [3] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [4] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.