Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV17I2D)

• DOT Name: Protein FAM156A/FAM156B (FAM156A)
• Synonyms: Transmembrane protein 29/29B
• Gene Name: FAM156A
• UniProt ID: FA156_HUMAN
• Pfam ID: PF15549
• Sequence:
  MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPE
  GLLRQRYREEKTLEERRWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRS
  QNRFRCECRYCQSHRPNLSGIPGESNRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAA
  LQPQETEEKRQRERQQESKIMFQRLLKQWLEEN

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the methylation of Protein FAM156A/FAM156B (FAM156A).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Protein FAM156A/FAM156B (FAM156A).	[5]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein FAM156A/FAM156B (FAM156A).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein FAM156A/FAM156B (FAM156A).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein FAM156A/FAM156B (FAM156A).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Protein FAM156A/FAM156B (FAM156A).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Protein FAM156A/FAM156B (FAM156A).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein FAM156A/FAM156B (FAM156A).	[7]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Protein FAM156A/FAM156B (FAM156A).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein FAM156A/FAM156B (FAM156A).	[8]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Protein FAM156A/FAM156B (FAM156A).	[9]

References

• [1] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.