Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV8WY4S)

• DOT Name: Negative regulator of P-body association (NBDY)
• Synonyms: P-body dissociating protein; Protein NoBody
• Gene Name: NBDY
• Related Disease:
  Systemic lupus erythematosus
  Nasopharyngeal carcinoma
  Neoplasm
  Pancreatic cancer
• UniProt ID: NBDY_HUMAN
• Sequence:
  MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLK
  SHPPPPEK
• Function: Promotes dispersal of P-body components and is likely to play a role in the mRNA decapping process.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[1]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[2]
Neoplasm	DISZKGEW	Limited	Altered Expression	[3]
Pancreatic cancer	DISJC981	Limited	Biomarker	[3]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Negative regulator of P-body association (NBDY).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Negative regulator of P-body association (NBDY).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Negative regulator of P-body association (NBDY).	[7]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Negative regulator of P-body association (NBDY).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Negative regulator of P-body association (NBDY).	[6]

References

• [1] Discovery of a novel genetic susceptibility locus on X chromosome for systemic lupus erythematosus.Arthritis Res Ther. 2015 Dec 3;17:349. doi: 10.1186/s13075-015-0857-1.
• [2] High Expression of LINC01420 indicates an unfavorable prognosis and modulates cell migration and invasion in nasopharyngeal carcinoma.J Cancer. 2017 Jan 1;8(1):97-103. doi: 10.7150/jca.16819. eCollection 2017.
• [3] Long Non-coding RNA LINC01420 Contributes to Pancreatic Cancer Progression Through Targeting KRAS Proto-oncogene.Dig Dis Sci. 2020 Apr;65(4):1042-1052. doi: 10.1007/s10620-019-05829-7. Epub 2019 Sep 27.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.