General Information of Drug Off-Target (DOT) (ID: OTVBTDNF)

DOT Name Probable E3 SUMO-protein ligase RNF212 (RNF212)
Synonyms EC 2.3.2.-; Probable E3 SUMO-protein transferase RNF212; RING finger protein 212
Gene Name RNF212
Related Disease
Male infertility ( )
Spermatogenic failure 62 ( )
UniProt ID
RN212_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.2.-
Pfam ID
PF14634
Sequence
MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLGKGKKNECLICKAPCRTVLLSKHTDA
DIQAFFMSIDSLCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQ
SMRSSQQTAFSTIKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARI
SMISPPQDGRMGPHLTASFCFIPWLTLSKPPVPGECVISRGSPCFCIDVCPHWLLLLAFS
SGRHGELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTPAVSVVFPLCQFERKKSF
Function
SUMO E3 ligase that acts as a regulator of crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes. Localizes to recombination sites and stabilizes meiosis-specific recombination factors, such as MutS-gamma complex proteins (MSH4 and MSH5) and TEX11. May mediate sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites. Acts as a limiting factor for crossover designation and/or reinforcement and plays an antagonist role with CCNB1IP1/HEI10 in the regulation of meiotic recombination.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Male infertility DISY3YZZ Strong Biomarker [1]
Spermatogenic failure 62 DISDIJP8 Limited Autosomal recessive [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Probable E3 SUMO-protein ligase RNF212 (RNF212). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Probable E3 SUMO-protein ligase RNF212 (RNF212). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Probable E3 SUMO-protein ligase RNF212 (RNF212). [7]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Probable E3 SUMO-protein ligase RNF212 (RNF212). [4]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Probable E3 SUMO-protein ligase RNF212 (RNF212). [5]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Probable E3 SUMO-protein ligase RNF212 (RNF212). [8]
------------------------------------------------------------------------------------

References

1 Sequencing of a 'mouse azoospermia' gene panel in azoospermic men: identification of RNF212 and STAG3 mutations as novel genetic causes of meiotic arrest.Hum Reprod. 2019 Jun 4;34(6):978-988. doi: 10.1093/humrep/dez042.
2 An ENU-induced mutation in the mouse Rnf212 gene is associated with male meiotic failure and infertility. Reproduction. 2015 Jan;149(1):67-74. doi: 10.1530/REP-14-0122. Epub 2014 Oct 23.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
5 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
8 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.