Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTVBTDNF)
| DOT Name | Probable E3 SUMO-protein ligase RNF212 (RNF212) | ||||
|---|---|---|---|---|---|
| Synonyms | EC 2.3.2.-; Probable E3 SUMO-protein transferase RNF212; RING finger protein 212 | ||||
| Gene Name | RNF212 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| EC Number | |||||
| Pfam ID | |||||
| Sequence |
MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLGKGKKNECLICKAPCRTVLLSKHTDA
DIQAFFMSIDSLCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQ SMRSSQQTAFSTIKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARI SMISPPQDGRMGPHLTASFCFIPWLTLSKPPVPGECVISRGSPCFCIDVCPHWLLLLAFS SGRHGELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTPAVSVVFPLCQFERKKSF |
||||
| Function |
SUMO E3 ligase that acts as a regulator of crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes. Localizes to recombination sites and stabilizes meiosis-specific recombination factors, such as MutS-gamma complex proteins (MSH4 and MSH5) and TEX11. May mediate sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites. Acts as a limiting factor for crossover designation and/or reinforcement and plays an antagonist role with CCNB1IP1/HEI10 in the regulation of meiotic recombination.
|
||||
Molecular Interaction Atlas (MIA) of This DOT
|
2 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
3 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
References
