Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTVC407Y)
| DOT Name | CMRF35-like molecule 7 (CD300LB) | ||||
|---|---|---|---|---|---|
| Synonyms |
CLM-7; CD300 antigen-like family member B; CMRF35-A2; Immune receptor expressed on myeloid cells 3; IREM-3; Leukocyte mono-Ig-like receptor 5; Triggering receptor expressed on myeloid cells 5; TREM-5; CD antigen CD300b
|
||||
| Gene Name | CD300LB | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKI
LIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVI VDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPE EPGEQPIYMNFSEPLTKDMAT |
||||
| Function | Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. | ||||
| Tissue Specificity | Expressed exclusively in myeloid lineages. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||
References
