Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVDZVD0)

DOT Name Coiled-coil domain-containing protein 102B (CCDC102B)
Gene Name CCDC102B
Related Disease
Blindness ( )
Myopia ( )
Bipolar disorder ( )
Schizoaffective disorder ( )
Schizophrenia ( )
Stroke ( )
UniProt ID
C102B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNLDSIHRLIEETQIFQMQQSSIKSRGDMVAPASPPRDTCNTCFPLHGLQSHAAHNFCAH
SYNTNKWDICEELRLRELEEVKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEG
RQLRIKLEMAMKELSTLKKKQSLPPQKEALEAKVTQDLKLPGFVEESCEHTDQFQLSSQM
HESIREYLVKRQFSTKEDTNNKEQGVVIDSLKLSEEMKPNLDGVDLFNNGGSGNGETKTG
LRLKAINLPLENEVTEISALQVHLDEFQKILWKEREMRTALEKEIERLESALSLWKWKYE
ELKESKPKNVKEFDILLGQHNDEMQELSGNIKEESKSQNSKDRVICELRAELERLQAENT
SEWDKREILEREKQGLERENRRLKIQVKEMEELLDKKNRLSANSQSPDFKMSQIDLQEKN
QELLNLQHAYYKLNRQYQANIAELTHANNRVDQNEAEVKKLRLRVEELKQGLNQKEDELD
DSLNQIRKLQRSLDEEKERNENLETELRHLQNW
Function
During interphase, forms fibers at the proximal ends of centrioles to maintain centrosome cohesion. During mitosis, dissociates from the centrosome following phosphorylation to allow centrosome separation. Contributes to CROCC/rootletin filament formation.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Blindness DISTIM10 Strong Biomarker [1]
Myopia DISK5S60 Strong Biomarker [1]
Bipolar disorder DISAM7J2 moderate Genetic Variation [2]
Schizoaffective disorder DISLBW6B moderate Genetic Variation [2]
Schizophrenia DISSRV2N moderate Genetic Variation [2]
Stroke DISX6UHX moderate Genetic Variation [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Coiled-coil domain-containing protein 102B (CCDC102B). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Coiled-coil domain-containing protein 102B (CCDC102B). [5]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Coiled-coil domain-containing protein 102B (CCDC102B). [6]
Progesterone DMUY35B Approved Progesterone increases the expression of Coiled-coil domain-containing protein 102B (CCDC102B). [7]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the methylation of Coiled-coil domain-containing protein 102B (CCDC102B). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Coiled-coil domain-containing protein 102B (CCDC102B). [9]
------------------------------------------------------------------------------------

References

1 CCDC102B confers risk of low vision and blindness in high myopia.Nat Commun. 2018 May 3;9(1):1782. doi: 10.1038/s41467-018-03649-3.
2 Genome-wide association studies of smooth pursuit and antisaccade eye movements in psychotic disorders: findings from the B-SNIP study.Transl Psychiatry. 2017 Oct 24;7(10):e1249. doi: 10.1038/tp.2017.210.
3 Genetic mapping and exome sequencing identify 2 mutations associated with stroke protection in pediatric patients with sickle cell anemia.Blood. 2013 Apr 18;121(16):3237-45. doi: 10.1182/blood-2012-10-464156. Epub 2013 Feb 19.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
7 Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
8 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.