Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVEH7V5)

DOT Name LRP2-binding protein (LRP2BP)
Synonyms Megalin-binding protein; MegBP
Gene Name LRP2BP
Related Disease
Arteriosclerosis ( )
Atherosclerosis ( )
Autism spectrum disorder ( )
Asthma ( )
Intellectual disability ( )
Schizophrenia ( )
facioscapulohumeral muscular dystrophy ( )
UniProt ID
LR2BP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF08238
Sequence
MKLTSEKLPKNPFYASVSQYAAKNQKFFQWKKEKTDYTHANLVDKALQLLKERILKGDTL
AYFLRGQLYFEEGWYEEALEQFEEIKEKDHQATYQLGVMYYDGLGTTLDAEKGVDYMKKI
LDSPCPKARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLG
LYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDTEAALQCLREAAER
GNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMAS
FYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSLLIRQRI
Function May act as an adapter that regulates LRP2 function.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arteriosclerosis DISK5QGC Strong Biomarker [1]
Atherosclerosis DISMN9J3 Strong Biomarker [1]
Autism spectrum disorder DISXK8NV Strong Biomarker [2]
Asthma DISW9QNS moderate Genetic Variation [3]
Intellectual disability DISMBNXP Disputed Genetic Variation [4]
Schizophrenia DISSRV2N Disputed Genetic Variation [4]
facioscapulohumeral muscular dystrophy DISSE0H0 Limited Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of LRP2-binding protein (LRP2BP). [6]
------------------------------------------------------------------------------------

References

1 LncRNA-RP11-714G18.1 suppresses vascular cell migration via directly targeting LRP2BP.Immunol Cell Biol. 2018 Feb;96(2):175-189. doi: 10.1111/imcb.1028. Epub 2017 Dec 7.
2 Allele-specific expression in a family quartet with autism reveals mono-to-biallelic switch and novel transcriptional processes of autism susceptibility genes.Sci Rep. 2018 Mar 9;8(1):4277. doi: 10.1038/s41598-018-22753-4.
3 Asthma-susceptibility variants identified using probands in case-control and family-based analyses.BMC Med Genet. 2010 Aug 10;11:122. doi: 10.1186/1471-2350-11-122.
4 Differential DNA methylation at birth associated with mental disorder in individuals with 22q11.2 deletion syndrome.Transl Psychiatry. 2017 Aug 29;7(8):e1221. doi: 10.1038/tp.2017.181.
5 Expression profile of FSHD supports a link between retinal vasculopathy and muscular dystrophy.Neurology. 2007 Feb 20;68(8):569-77. doi: 10.1212/01.wnl.0000251269.31442.d9. Epub 2006 Dec 6.
6 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.