Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVJZIOR)

• DOT Name: Transmembrane protein 200A (TMEM200A)
• Gene Name: TMEM200A
• Related Disease:
  Medulloblastoma
  Mental disorder
• UniProt ID: T200A_HUMAN
• Pfam ID: PF10177
• Sequence:
  MIATGGVITGLAALKRQDSARSQQHVNLSPSPATQEKKPIRRRPRADVVVVRGKIRLYSP
  SGFFLILGVLISIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNEGGVVVRFFEQHL
  HSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQRQ
  MNGMYTGLMGETEVKQNGSSCASRLAANTIASFSGFRSSFRMDSSVEEDELMLNEGKSSG
  HLMPPLLSDSSVSVFGLYPPPSKTTDDKTSGSKKCETKSIVSSSISAFTLPVIKLNNCVI
  DEPSIDNITEDADNLKSRSRNLSMDSLVVPLPNTSESFQPVSTVLPRNNSIGESLSSQYK
  SSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWP
  RLDRNNSKGYMKLENKEDPMDRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSN
  NLKRGTSETRF
• Tissue Specificity: Expressed in cerebellum.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Medulloblastoma	DISZD2ZL	Strong	Altered Expression	[1]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[2]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transmembrane protein 200A (TMEM200A).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transmembrane protein 200A (TMEM200A).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Transmembrane protein 200A (TMEM200A).	[5]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Transmembrane protein 200A (TMEM200A).	[6]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Transmembrane protein 200A (TMEM200A).	[7]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Transmembrane protein 200A (TMEM200A).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transmembrane protein 200A (TMEM200A).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Transmembrane protein 200A (TMEM200A).	[12]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transmembrane protein 200A (TMEM200A).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Transmembrane protein 200A (TMEM200A).	[11]

References

• [1] Identification of a novel homozygous deletion region at 6q23.1 in medulloblastomas using high-resolution array comparative genomic hybridization analysis.Clin Cancer Res. 2005 Jul 1;11(13):4707-16. doi: 10.1158/1078-0432.CCR-05-0128.
• [2] Candidate psychiatric illness genes identified in patients with pericentric inversions of chromosome 18.Psychiatr Genet. 2005 Mar;15(1):37-44. doi: 10.1097/00041444-200503000-00007.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [5] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [6] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [7] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [8] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [12] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.